A database of hormones and their receptors

Home

Hormone Peptide Non-peptide Search Search Browse Browse H-R Pair H-R Pair

Receptor Search Browse

Tools BLAST Domain Search Peptide Mapping Structure Search

Miscellaneous Online Submission HMRbase Information Supplementary Information Recent Information Help

Contact

Peptide Hormone

Search Result - 1

HMRbase accession number	10121
Swiss-prot Accession number	Q2Q1P1 (Sequence in FASTA format)
Description	Lutropin subunit beta precursor (Luteinizing hormone subunit beta)(LSH-beta) (LSH-B) (LH-B) (Lutropin beta chain).
Source organism	Gorilla gorilla gorilla (Lowland gorilla)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;Catarrhini; Hominidae; Gorilla.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the glycoprotein hormones subunit beta family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Promotes spermatogenesis and ovulation by stimulating the testes and ovaries to synthesize steroids
Protein Length	141 Amino acids
Molecular weight	15262
References	1   Hallast P., Rull K., Laan M.; "What is the evidence for the functionality of CGB1 and CGB2?"; Submitted (OCT-2005) to the EMBL/GenBank/DDBJ databases.
Domain Name	Cys_knot
Hormone Name	Luteinizing hormone subunit beta (LSH-B) (LH-B)(Lutropin subunit beta)
Mature Hormone Sequence	SREPLRPRCRPINATLAVEKEGCPVCITVNTTICAGYCPTMMRVLQGVLPPLPQVVCTYRDVRFESIXLPGCPRGVDPMVSFPVALSCRCGPCHRSTSDCGGPNDHPLTCDHPQLSGLLFL
Position of mature hormone in Pre-Hormone protein	121 Residues from position (21-141)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 2

HMRbase accession number	10170
Swiss-prot Accession number	Q6YK33 (Sequence in FASTA format)
Description	Insulin precursor [Contains: Insulin B chain; Insulin A chain].
Source organism	Gorilla gorilla gorilla (Lowland gorilla)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;Catarrhini; Hominidae; Gorilla.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	110 Amino acids
Molecular weight	11981
References	1  PubMed abstract 12952878
Domain Name	Insulin
Hormone Name	Insulin B chain
Mature Hormone Sequence	FVNQHLCGSHLVEALYLVCGERGFFYTPKT
Position of mature hormone in Pre-Hormone protein	30 Residues from position (25-54)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 3

HMRbase accession number	10171
Swiss-prot Accession number	Q6YK33 (Sequence in FASTA format)
Description	Insulin precursor [Contains: Insulin B chain; Insulin A chain].
Source organism	Gorilla gorilla gorilla (Lowland gorilla)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;Catarrhini; Hominidae; Gorilla.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	110 Amino acids
Molecular weight	11981
References	1  PubMed abstract 12952878
Domain Name	Insulin
Hormone Name	Insulin A chain
Mature Hormone Sequence	GIVEQCCTSICSLYQLENYCN
Position of mature hormone in Pre-Hormone protein	21 Residues from position (90-110)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 4

HMRbase accession number	10984
Swiss-prot Accession number	A1BN60 (Sequence in FASTA format)
Description	Follitropin subunit beta precursor (Follicle-stimulating hormone betasubunit) (FSH-beta) (FSH-B) (Follitropin beta chain).
Source organism	Gorilla gorilla gorilla (Lowland gorilla)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;Catarrhini; Hominidae; Gorilla.
Subcellular location	Secreted (By similarity)
Developmental Stage	N/A
Similarity	Belongs to the glycoprotein hormones subunit beta family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Stimulates development of follicle and spermatogenesis in the reproductive organs
Protein Length	129 Amino acids
Molecular weight	14686
References	1  PubMed abstract 17227474 2  PubMed abstract 17227474
Domain Name	Cys_knot
Hormone Name	Follicle-stimulating hormone beta subunit
Mature Hormone Sequence	CELTNITIAIEKEECRFCISINTTWCAGYCYTRDLVYKDPARPNIQKTCTFKELVYETVRVPGCAHHADSLYTYPVATQCHCGKCDSDSTDCTVRGLGPSYCSFGEMKE
Position of mature hormone in Pre-Hormone protein	Residues from position 109
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 5

HMRbase accession number	11529
Swiss-prot Accession number	Q95189 (Sequence in FASTA format)
Description	Leptin;Alternative Name: Obesity factor
Source organism	Gorilla gorilla gorilla (Lowland gorilla)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;Catarrhini; Hominidae; Gorilla.
Subcellular location	Secreted (Probable)
Developmental Stage	N/A
Similarity	Belongs to the leptin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	May function as part of a signaling pathway that acts to regulate the size of the body fat depot. An increase in the level of LEP may act directly or indirectly on the CNS to inhibit food intake and/or regulate energy expenditure as part of a homeostatic mechanism to maintain constancy of the adipose mass (By similarity).
Protein Length	146 Amino acids
Molecular weight	16031
References	----
Domain Name	Leptin
Hormone Name	Leptin
Mature Hormone Sequence
Position of mature hormone in Pre-Hormone protein
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated